INT205806

From wiki-pain
Jump to: navigation, search
Context Info
Confidence 0.49
First Reported 2007
Last Reported 2010
Negated 0
Speculated 0
Reported most in Body
Documents 16
Total Number 16
Disease Relevance 6.43
Pain Relevance 0.31

This is a graph with borders and nodes. Maybe there is an Imagemap used so the nodes may be linking to some Pages.

plasma membrane (ERVW-1)
Anatomy Link Frequency
brain 5
T cell 2
tail 1
spleen 1
ERVW-1 (Homo sapiens)
Pain Link Frequency Relevance Heat
addiction 420 91.92 High High
Potency 33 88.48 High High
medulla 2 26.56 Quite Low
Spinal cord 2 25.36 Quite Low
Central nervous system 57 5.00 Very Low Very Low Very Low
chemokine 26 5.00 Very Low Very Low Very Low
cytokine 22 5.00 Very Low Very Low Very Low
antagonist 16 5.00 Very Low Very Low Very Low
anesthesia 12 5.00 Very Low Very Low Very Low
Angina 6 5.00 Very Low Very Low Very Low
Disease Link Frequency Relevance Heat
Acquired Immune Deficiency Syndrome Or Hiv Infection 596 100.00 Very High Very High Very High
Infection 551 99.24 Very High Very High Very High
Asymptomatic Infections 8 97.80 Very High Very High Very High
Sprains And Strains 103 97.34 Very High Very High Very High
Viral Meningitis 58 89.24 High High
Disease Progression 7 88.32 High High
Pox Virus Infection 52 86.00 High High
Contagious Ecthyma 5 83.00 Quite High
Diarrhoea 8 82.28 Quite High
Weight Loss 8 81.88 Quite High

Sentences Mentioned In

Key: Protein Mutation Event Anatomy Negation Speculation Pain term Disease term
The TMstop strains contained a glutamic acid to stop-codon change at position 767 (E767*) that truncates the cytoplasmic domain of gp41 and results in increased envelope incorporation into virions and increased virus infectivity [35].
Positive_regulation (increased) of env associated with sprains and strains
1) Confidence 0.49 Published 2009 Journal PLoS Pathogens Section Body Doc Link PMC2621341 Disease Relevance 1.28 Pain Relevance 0
Though more than 20 publications have clonally sequenced HIV env from the brain, assembling a meta-dataset of these sequences presents significant technical challenges.
Positive_regulation (sequenced) of env in brain associated with acquired immune deficiency syndrome or hiv infection
2) Confidence 0.47 Published 2010 Journal AIDS Res Ther Section Body Doc Link PMC3018377 Disease Relevance 0.83 Pain Relevance 0
Because LV vector-mediated gene expression is rapid, and tropism can be manipulated by changing the envelope protein expressed in the cell line used for viral packaging [12], we believe that it can be effectively utilized to identify functional, cell-specific promoters in diverse experimental paradigms.
Positive_regulation (changing) of envelope protein
3) Confidence 0.45 Published 2007 Journal Molecular Vision Section Body Doc Link PMC2765473 Disease Relevance 0.08 Pain Relevance 0
To test whether we would be able to produce pseudotype viruses and perform infection experiments utilizing a different expression vector, we sub-cloned most of the gp160 coding regions, except for the first 11 amino acids after the signal peptide in gp120 and the last 132 amino acids in gp41 (which were identical in the brain and spleen derived parental Env), from the BR, SPL, BS and SB env clones in pcDNA3.1 into the pHXB2-env vector [72] in which efficient expression is obtained from an SV40 promoter.
Positive_regulation (derived) of Env in spleen associated with infection
4) Confidence 0.44 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.26 Pain Relevance 0
By contrast, only those pseudotypes with low CD4-dependent Env showed the ability to infect MDMs, although with various efficiencies.
Positive_regulation (dependent) of Env
5) Confidence 0.44 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.50 Pain Relevance 0.03
We had previously described that the increase in fusogenicity of brain-derived Env from this individual correlated with reduced sensitivity to the fusion inhibitor T-1249 [54].
Positive_regulation (derived) of Env in brain
6) Confidence 0.44 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0 Pain Relevance 0.09
Thus, T-20 (also known as Enfuvirtide) and T-1249, as well as derived peptides T-20-BR (YTNLIYNLIEKSQNQQEMNEQELLKLDTWASLWNWF) and T-1249-BR (WQEWEQKITALLEQAQIQQEMNEQELQKLDTWASLWEWF) that contain amino acid changes present in the HR2 region of H0002GH brain-derived Env (shown in bold), were synthesized and used for inhibition of infection by pseudotypes containing wild-type, chimeric and mutant Env.
Positive_regulation (used) of Env in brain associated with infection
7) Confidence 0.44 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.10 Pain Relevance 0.04
In addition, asparagine in position 362 in gp120's C3 region, which has been found in a higher proportion of CCR5-using Env derived from AIDS patients than from individuals with asymptomatic infection, has been shown to contribute, albeit in a strain-dependent manner, to increased fusogenicity and higher sensitivity to an anti-CD4bs mAb, perhaps by promoting greater exposure of the CD4bs and/or stabilizing the CD4-bound Env conformation [91].
Positive_regulation (proportion) of Env associated with asymptomatic infections, acquired immune deficiency syndrome or hiv infection and sprains and strains
8) Confidence 0.44 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.79 Pain Relevance 0.09
Additional chimeric Env containing the brain V1/V2-C2-V3 fragment in the context of spleen Env and vice versa (Bv1v3 and Sv1v3, respectively) were generated, since numerous amino acid differences between the brain and spleen Env cluster in this gp120 region, which has previously been shown to contain the determinants for increased fusogenicity and low CD4 dependence in the Env of the in vitro microglia-adapted isolate HIV-1Bori-15 [49,50].
Positive_regulation (generated) of Env in brain associated with addiction and acquired immune deficiency syndrome or hiv infection
9) Confidence 0.41 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.17 Pain Relevance 0.05
In addition, we have used QuikChange site-directed mutagenesis to generate the Env mutant DS17(N283T), in which the N283 residue present in the DS17 clone was mutated to T.
Positive_regulation (generate) of Env
10) Confidence 0.41 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.45 Pain Relevance 0
Two blinded positive control specimens each consisting of goat polyclonal MuLV whole virus antisera diluted 1:100 in pre-immune goat sera both tested positive in the recombinant Gag ELISAs but were negative in the Env ELISA.
Positive_regulation (negative) of Env ELISA
11) Confidence 0.39 Published 2010 Journal Retrovirology Section Body Doc Link PMC2908559 Disease Relevance 0.28 Pain Relevance 0
Hence, the functional relevance of Env (and Gag) specific CD4+ and CD8+ T cells in setting of vaccination for prevention of infection needs to be further explored.
Positive_regulation (relevance) of Env in T cells associated with infection
12) Confidence 0.27 Published 2010 Journal PLoS ONE Section Body Doc Link PMC2981570 Disease Relevance 0.69 Pain Relevance 0
In humans, the use of recombinant multigenic MVA as a vector for both priming and boosting immune responses appears to be similar to multigenic DNA vaccines, which also induce primarily CD4+ T cell responses against Env-derived gene products [17], [18], [19], [20].
Positive_regulation (induce) of Env in T cell
13) Confidence 0.27 Published 2010 Journal PLoS ONE Section Body Doc Link PMC2981570 Disease Relevance 0.18 Pain Relevance 0
To test whether we would be able to produce pseudotype viruses and perform infection experiments utilizing a different expression vector, we sub-cloned most of the gp160 coding regions, except for the first 11 amino acids after the signal peptide in gp120 and the last 132 amino acids in gp41 (which were identical in the brain and spleen derived parental Env), from the BR, SPL, BS and SB env clones in pcDNA3.1 into the pHXB2-env vector [72] in which efficient expression is obtained from an SV40 promoter.
Positive_regulation (derived) of Env in brain associated with infection
14) Confidence 0.15 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.26 Pain Relevance 0
Truncation of the gp41 cytoplasmic tail at this position was also shown to increase envelope glycoprotein incorporation into virions and to enhance virus infectivity [32],[35],[36].
Positive_regulation (increase) of envelope glycoprotein in tail
15) Confidence 0.15 Published 2009 Journal PLoS Pathogens Section Body Doc Link PMC2621341 Disease Relevance 0.49 Pain Relevance 0
Rex is required for the accumulation of genomic and singly-spliced env RNAs [101].
Positive_regulation (accumulation) of env
16) Confidence 0.12 Published 2007 Journal Retrovirology Section Body Doc Link PMC1839114 Disease Relevance 0.08 Pain Relevance 0

General Comments

This test has worked.

Personal tools
Namespaces

Variants
Actions
Navigation
Toolbox