INT79358

From wiki-pain
Jump to: navigation, search
Context Info
Confidence 0.75
First Reported 1999
Last Reported 2010
Negated 2
Speculated 0
Reported most in Body
Documents 65
Total Number 66
Disease Relevance 29.90
Pain Relevance 1.31

This is a graph with borders and nodes. Maybe there is an Imagemap used so the nodes may be linking to some Pages.

plasma membrane (ERVW-1)
Anatomy Link Frequency
brain 7
HOS 2
SPL 2
neuronal 1
B cells 1
ERVW-1 (Homo sapiens)
Pain Link Frequency Relevance Heat
Multiple sclerosis 26 99.32 Very High Very High Very High
Potency 100 97.08 Very High Very High Very High
anesthesia 64 95.04 Very High Very High Very High
addiction 894 88.32 High High
Inflammation 66 87.88 High High
iatrogenic 6 85.44 High High
Demyelination 4 70.80 Quite High
cytokine 237 68.72 Quite High
Glutamate 2 65.20 Quite High
ketamine 17 60.96 Quite High
Disease Link Frequency Relevance Heat
Acquired Immune Deficiency Syndrome Or Hiv Infection 2797 100.00 Very High Very High Very High
Sprains And Strains 381 99.98 Very High Very High Very High
Infection 2009 99.84 Very High Very High Very High
Death 61 99.80 Very High Very High Very High
Burns 364 99.68 Very High Very High Very High
Paratuberculosis 80 99.64 Very High Very High Very High
Pressure And Volume Under Development 30 99.60 Very High Very High Very High
Pox Virus Infection 156 99.58 Very High Very High Very High
Demyelinating Disease 36 99.32 Very High Very High Very High
Cold Sores 735 98.92 Very High Very High Very High

Sentences Mentioned In

Key: Protein Mutation Event Anatomy Negation Speculation Pain term Disease term
Another group of putative MuERVs, defective in their genome structures, had intact coding potentials for gag, pol, and/or env polypeptides and it is likely that changes in the expression of these individual proteins affect the host cells' normal physiology, such as overexpression of syncytin in the brain of multiple sclerosis patients.
Gene_expression (overexpression) of syncytin in brain associated with multiple sclerosis
1) Confidence 0.75 Published 2007 Journal BMC Genomics Section Body Doc Link PMC2241634 Disease Relevance 0.43 Pain Relevance 0.05
Each dose contained a mixture of three scSIV strains expressing full-length envelope glycoproteins, scSIVmac239 TMopen, scSIVmac316 TMopen and scSIVmac155T3 TMopen (Figure 1A) [32].
Gene_expression (expressing) of env associated with sprains and strains
2) Confidence 0.75 Published 2009 Journal PLoS Pathogens Section Body Doc Link PMC2621341 Disease Relevance 0.52 Pain Relevance 0
Single-cycle SIV retains many of the potentially advantageous properties of live, attenuated SIV, including the expression of 8 of the 9 viral antigens, the absence of any vector-derived gene products, and the expression of the native, oligomeric conformation of envelope on the surface of infected cells and virions.
Gene_expression (expression) of env
3) Confidence 0.75 Published 2009 Journal PLoS Pathogens Section Body Doc Link PMC2621341 Disease Relevance 0.69 Pain Relevance 0
Because LV vector-mediated gene expression is rapid, and tropism can be manipulated by changing the envelope protein expressed in the cell line used for viral packaging [12], we believe that it can be effectively utilized to identify functional, cell-specific promoters in diverse experimental paradigms.
Gene_expression (expressed) of envelope protein
4) Confidence 0.75 Published 2007 Journal Molecular Vision Section Body Doc Link PMC2765473 Disease Relevance 0.08 Pain Relevance 0
All responders formed antibodies to conformationally intact HIV-1 B'/C envelope expressed on Vero cells, as measured by immunofluorescent staining.
Gene_expression (expressed) of env associated with acquired immune deficiency syndrome or hiv infection
5) Confidence 0.75 Published 2010 Journal PLoS ONE Section Body Doc Link PMC2810329 Disease Relevance 0.57 Pain Relevance 0.03
To produce Env-pseudotyped, luciferase-reporter viruses, 293T cells were co-transfected using calcium phosphate precipitation (ProFection Mammalian Transfection System, Promega, Madison, WI) with each Env expression vector and with the Env-deficient, pNL4-3-luc+env- provirus, developed by N.
Gene_expression (expression) of Env
6) Confidence 0.69 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.29 Pain Relevance 0
After removing the inoculum and washing with PBS, DMEM supplemented with rifampicin was added and the cells were subsequently transfected by calcium phosphate precipitation with an Env expression vector (or empty pcDNA3.1 as a negative control).
Gene_expression (expression) of Env
7) Confidence 0.69 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.37 Pain Relevance 0
As shown in Figure 7, HOS-CD4-CCR5 cells were infected to a similar extent by all pseudotypes, with luciferase activity at least 1000-fold above background levels (mock infection refers to supernatants containing viral particles lacking Env produced by cells co-transfected with the Env-deficient luciferase backbone and an empty vector).
Neg (lacking) Gene_expression (produced) of Env in HOS associated with infection
8) Confidence 0.69 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.48 Pain Relevance 0.04
Three different envelope variants of single-cycle SIV expressing full-length (TMopen) or truncated (TMstop) forms of the 239, 316 and 155T3 envelope glycoproteins were used for immunization [32].
Gene_expression (expressing) of env associated with immunization
9) Confidence 0.65 Published 2009 Journal PLoS Pathogens Section Body Doc Link PMC2621341 Disease Relevance 0.62 Pain Relevance 0
Consistent with a previous study [25], cells expressing the antisense envelope inhibitor also demonstrated a slight increase in the percentage of transduced cells during the 25 day observation period, an effect that was most evident for the cultures containing 25% and 60% transduced cells, while no clear selective advantage was evident for the cultures containing 1% or 10% transduced cells.
Gene_expression (expressing) of env
10) Confidence 0.65 Published 2010 Journal PLoS ONE Section Body Doc Link PMC2925957 Disease Relevance 0.39 Pain Relevance 0
Although a dramatic increase in the frequency of maC46-GFP-expressing cells was observed, no significant expansion of cells expressing the VRX494 antisense envelope or the shRNA inhibitor was observed (Figure 3B).
Gene_expression (expressing) of env
11) Confidence 0.65 Published 2010 Journal PLoS ONE Section Body Doc Link PMC2925957 Disease Relevance 0.59 Pain Relevance 0
However, both specimens were negative by IFA testing using 293T cells expressing either XMRV Gag or Env proteins and were thus considered negative.
Gene_expression (expressing) of Env
12) Confidence 0.60 Published 2010 Journal Retrovirology Section Body Doc Link PMC2908559 Disease Relevance 0.43 Pain Relevance 0
To produce Env-pseudotyped, luciferase-reporter viruses, 293T cells were co-transfected using calcium phosphate precipitation (ProFection Mammalian Transfection System, Promega, Madison, WI) with each Env expression vector and with the Env-deficient, pNL4-3-luc+env- provirus, developed by N.
Gene_expression (produce) of Env-pseudotyped
13) Confidence 0.60 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.18 Pain Relevance 0
To investigate the avidity of the interaction between Env trimers in the surface of viral particles and CD4 in the target cell membrane, HOS-CD4-CCR5 cells plated in 96-well plates 24 hours before infection, were incubated for 30–60 minutes at 4°C with 2× the final concentration of SK3 anti-CD4 mAb in a volume of 50 ?
Gene_expression (trimers) of Env in HOS associated with infection
14) Confidence 0.60 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.41 Pain Relevance 0
However, this delay should be the same for all Env, and differences observed in luciferase activity should therefore reflect differences in fusogenicity, that is, in the amount and rate of fusion mediated by each individual Env.
Gene_expression (same) of Env
15) Confidence 0.60 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0 Pain Relevance 0
To evaluate the role of N283 in various Env backgrounds, the Env mutants pSV-BR(N283T) and pSV-SPL(T283N) where the N283 present in the brain Env was mutated to T and the T283 present in the spleen Env was mutated to N, respectively, were created using QuikChange site-directed mutagenesis (Stratagene, La Jolla, CA) following manufacturer's instructions.
Gene_expression (backgrounds) of Env in brain
16) Confidence 0.60 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.19 Pain Relevance 0
In addition, all of these foot-print residues are present in both wild-type BR and SPL Env.
Gene_expression (present) of Env in foot
17) Confidence 0.60 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.08 Pain Relevance 0
Thus, it is interesting that only in the context of the SB chimera (but not with the wild-type brain-derived Env) and DS17, T-1249-BR seemed to show a slightly, but significant, higher potency than parental T-1249.
Gene_expression (context) of Env in brain associated with potency
18) Confidence 0.60 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0 Pain Relevance 0.13
There were 13 amino acid differences between the wild-type BR and SPL Env clones in V1/V2, 8 in V3 and 9 in V4, in addition to less numerous changes in more conserved Env regions.
Gene_expression (clones) of Env
19) Confidence 0.60 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.28 Pain Relevance 0.04
Thus, T-20 (also known as Enfuvirtide) and T-1249, as well as derived peptides T-20-BR (YTNLIYNLIEKSQNQQEMNEQELLKLDTWASLWNWF) and T-1249-BR (WQEWEQKITALLEQAQIQQEMNEQELQKLDTWASLWEWF) that contain amino acid changes present in the HR2 region of H0002GH brain-derived Env (shown in bold), were synthesized and used for inhibition of infection by pseudotypes containing wild-type, chimeric and mutant Env.
Gene_expression (synthesized) of Env in brain associated with infection
20) Confidence 0.60 Published 2008 Journal Retrovirology Section Body Doc Link PMC2576352 Disease Relevance 0.10 Pain Relevance 0.04

General Comments

This test has worked.

Personal tools
Namespaces

Variants
Actions
Navigation
Toolbox